HORDB

ID: hor004685
Uniprot ID: Q9FS10
Protein name: Phytosulfokine-alpha
Gene name: PSK
Organism: Asparagus officinalis (Garden asparagus)
Family: Phytosulfokine family
Source: Plant
Expression: Expression is regulated by a signal transduction pathway activated by auxin and cytokinin.
Disease: NA
Comments: NA
Taxonomy: Asparagus (genus), Asparagoideae (subfamily), Asparagaceae (family), Asparagales (order), Petrosaviidae (subclass), Liliopsida, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0030154 cell differentiation
GO CC: GO:0005576 extracellular region

Sequence: YIYTQ
Length: 5
Propeptide: MSSKAITLLLIALLFSLSLAQAARPLQPADSTKSVHVIPEKVHDEACEGVGEEECLMRRTLTAHVDYIYTQDHNP
Signal peptide: MSSKAITLLLIALLFSLSLAQA
Modification: T1 Sulfotyrosine;T3 Sulfotyrosine
Glycosylation: NA
Mutagenesis: 2-2I->V: Activity decreased 20-fold.

Function: Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.
Mechanism: The N-terminal tripeptide (YIY) is the active core.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004685_AF2.pdb

hor004685_ESM.pdb

Mass:	75829	Formula:	C33H46N6O10
Absent amino acids:	ACDEFGHKLMNPRSVW	Common amino acids:	Y
pI:	6.09	Basic residues:	0
Polar residues:	3	Hydrophobic residues:	1
Hydrophobicity:	-46	Boman Index:	-347
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	78
Instability Index:	-2406	Extinction Coefficient cystines:	2980
Absorbance 280nm:	745